Rabbit Anti-ZNF551 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-49749P

• Product Name:
• Rabbit Anti-ZNF551 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fragment corresponding to Human ZNF551 aa 61-113. Numbering is from isoform 1; sequence also occurs in isoforms 2 and 3. Sequence: NFAHVTSLGYCHGMENEAIASEQSVSIQVRTSKGNTPTQKTHLSEIKMCV PVL Database link: Q7Z340 Run BLAST with Run BLAST with

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• ICC/IF

• Storage Buffer:
• Immunogen affinity purified

• Storage Procedures:
• pH: 7.2 Preservative: 0.02% Sodium azide Constituents: 40% Glycerol, 59% PBS

• Clonality:
• Polyclonal

• Form:
• Liquid