• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-ZNF506 Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-49732P
  • Product Name:
  • Rabbit Anti-ZNF506 Polyclonal Antibody
  • Host Species:
  • Rabbit
  • Immunogen:
  • Synthetic peptide within Human ZNF506 aa 331-380 (C terminal). The exact sequence is proprietary. Isoform 2 Sequence: HTGEKPYKCEECGKAFTAFSTLTEHKIIHTGEKPYKCEECGKAFNWSSAL Database link: Q5JVG8-2 Run BLAST with Run BLAST with
  • Species Reactivity:
  • Human Predicted to work with: Mouse, Rat, Horse, Cow, Cat, Dog, Pig
  • Isotype:
  • IgG
  • Application:
  • WB
  • Storage Buffer:
  • Affinity purified
  • Storage Procedures:
  • Constituents: 98% PBS, 2% Sucrose
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Rabbit Anti-ZNF503 Polyclonal Antibody-FPA-49731P
  • Online Inquiry

    refresh