Rabbit Anti-ZNF506 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-49732P

• Product Name:
• Rabbit Anti-ZNF506 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human ZNF506 aa 331-380 (C terminal). The exact sequence is proprietary. Isoform 2 Sequence: HTGEKPYKCEECGKAFTAFSTLTEHKIIHTGEKPYKCEECGKAFNWSSAL Database link: Q5JVG8-2 Run BLAST with Run BLAST with

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Horse, Cow, Cat, Dog, Pig

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Affinity purified

• Storage Procedures:
• Constituents: 98% PBS, 2% Sucrose

• Clonality:
• Polyclonal

• Form:
• Liquid