Rabbit Anti-ZNF408 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-45478P

• Product Name:
• Rabbit Anti-ZNF408 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within the internal aa 575-624 ( ERPFPCPQCGRAYTLATKLRRHLKSHLEDKPYRCPTCGMGYTLPQSLRRH ) of Human ZNF408 (NP_079017).

• Species Reactivity:
• Human Predicted to work with: Mouse, Rabbit, Horse, Cow, Cat, Dog, Pig, Zebrafish

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid