Rabbit Anti-ZNF384 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-45458P

• Product Name:
• Rabbit Anti-ZNF384 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human ZNF384 aa 527-577. The exact sequence is proprietary. NP_001129206.1. Sequence: APQGGGGGDSNPNPPPQCSFDLTPYKTAEHHKDICLTVTTSTIQVEHLAS S

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Cow, Dog, Pig, Chimpanzee, Rhesus monkey, Gorilla, Orangutan

• Isotype:
• IgG

• Application:
• WB, IP

• Storage Buffer:
• Preservative: 0.09% Sodium azide Constituents: 0.1% BSA, 99% Tris buffered saline

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid