Rabbit Anti-ZNF312B Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-45411P

• Product Name:
• Rabbit Anti-ZNF312B Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a region corresponding within C terminal aa 397-446 ( CPTCGKGFCRNFDLKKHVRKLHDSSLGLARTPAGEPGTEPPPPLPQQPPM ) of Human ZNF312B (NP_001019784)

• Species Reactivity:
• Human Predicted to work with: Rat, Rabbit

• Isotype:
• IgG

• Application:
• IHC-P, WB

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid