Rabbit Anti-ZNF277 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-49663P

• Product Name:
• Rabbit Anti-ZNF277 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within N terminal aa 1-50 (MAASKTQGAVARMQEDRDGSCSTVGGVGYGDSKDCILEPLSLPESPGGT T ) of Human ZNF277 (NP_068834). Run BLAST with Run BLAST with

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Immunogen affinity purified

• Storage Procedures:
• Preservative: None Constituents: 2% Sucrose, PBS

• Clonality:
• Polyclonal

• Form:
• Liquid