Rabbit Anti-ZNF24 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-45384P

• Product Name:
• Rabbit Anti-ZNF24 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human ZNF24 aa 100-150. The exact sequence is proprietary. (NP_008896.2). Sequence: FVAILPKELQTWVRDHHPENGEEAVTVLEDLESELDDPGQPVSLRRRKRE V

• Species Reactivity:
• Human Predicted to work with: Rat, Horse, Cow, Dog, Pig, Chimpanzee, Cynomolgus monkey, Rhesus monkey, Gorilla, Orangutan

• Isotype:
• IgG

• Application:
• WB, IP

• Storage Buffer:
• Preservative: 0.09% Sodium azide Constituents: 99% Tris buffered saline, 0.1% BSA

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid