Rabbit Anti-ZNF232 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-49649P

• Product Name:
• Rabbit Anti-ZNF232 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human ZNF232 aa 351-400 (C terminal). The exact sequence is proprietary. Sequence: YECNECGKAFSQSSYLSQHRRIHSGEKPFICKECGKAYGWCSELIRHRRV Database link: Q9UNY5-2 Run BLAST with Run BLAST with

• Species Reactivity:
• Human Predicted to work with: Rat, Rabbit, Horse, Cow, Dog, Pig, Zebrafish

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Immunogen affinity purified

• Clonality:
• Polyclonal

• Form:
• Liquid