Rabbit Anti-ZMYM2 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-45281P

• Product Name:
• Rabbit Anti-ZMYM2 Polyclonal Antibody

• Formulation:
• There are 2 isoforms produced by alternative splicing.

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Mouse ZMYM2 aa 1070-1120 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary. Sequence: KYTYGVNAWKHWVKTRQLDEDLLVLDELKSSKSVKLKEDLLSHTTAELNY G

• Species Reactivity:
• Rat Predicted to work with: Mouse, Human

• Isotype:
• IgG

• Application:
• IHC-P

• Storage Buffer:
• Preservative: 0.09% Sodium azide Constituents: 1% BSA, 50% Glycerol

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal