Rabbit Anti-ZKSCAN1 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-49587P

• Product Name:
• Rabbit Anti-ZKSCAN1 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• A Synthetic peptide corresponding to a region within C terminal aa 386 - 435 ( YECNECGKAFSQSSDLTKHQRIHTGEKPYECSECGKAFNRNSYLILHRRI ) of Mouse ZKSCAN1 (NP_084145). Run BLAST with Run BLAST with

• Species Reactivity:
• Mouse Predicted to work with: Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Zebrafish

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Immunogen affinity purified

• Storage Procedures:
• Constituents: 97% PBS, 2% Sucrose

• Clonality:
• Polyclonal

• Form:
• Liquid