• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-ZKSCAN1 Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-49587P
  • Product Name:
  • Rabbit Anti-ZKSCAN1 Polyclonal Antibody
  • Host Species:
  • Rabbit
  • Immunogen:
  • A Synthetic peptide corresponding to a region within C terminal aa 386 - 435 ( YECNECGKAFSQSSDLTKHQRIHTGEKPYECSECGKAFNRNSYLILHRRI ) of Mouse ZKSCAN1 (NP_084145). Run BLAST with Run BLAST with
  • Species Reactivity:
  • Mouse Predicted to work with: Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Isotype:
  • IgG
  • Application:
  • WB
  • Storage Buffer:
  • Immunogen affinity purified
  • Storage Procedures:
  • Constituents: 97% PBS, 2% Sucrose
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Rabbit Anti-zinc finger protein 775 Polyclonal Antibody-FPA-49586P
  • Online Inquiry

    refresh