Rabbit Anti-Zinc finger protein 709 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-45257P

• Product Name:
• Rabbit Anti-Zinc finger protein 709 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to Human Zinc finger protein 709 aa 61-110 (N terminal). Sequence: KLRSHMVERLCERKEGSQFGETISQTPNPKPNKKTFTRVKPYECSVCGKD

• Species Reactivity:
• Human Predicted to work with: Dog

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid