Rabbit Anti-ZFP62 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-45194P

• Product Name:
• Rabbit Anti-ZFP62 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide, corresponding to a region within internal sequence aa 70-120 (TGEKPYECDICGKTFSNSSGLRVHKRIHTGEKPYECDECGKAFITCRTL L) of Human ZFP62 (Q8NB50)

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Cow, Cat, Dog, Pig

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid