Rabbit Anti-Zfp275 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-49557P

• Product Name:
• Rabbit Anti-Zfp275 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within internal sequence aa 350-399 ( LAEHQRIHSGAKPYGCPHCGKLFRRSSELTKHRRIHTGEKPYECNQCGKA ) of Mouse Zfp275 (NP_113682). Run BLAST with Run BLAST with

• Species Reactivity:
• Mouse Predicted to work with: Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Human, Pig

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Immunogen affinity purified

• Storage Procedures:
• Constituents: 97% PBS, 2% Sucrose

• Clonality:
• Polyclonal

• Form:
• Liquid