Cat#:FPA-49551P;Product Name:Rabbit Anti-ZFAND2B Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human ZFAND2B aa 80-129 (N terminal). The exact sequence is proprietary. (NP_620157.1) Sequence: IDRDCRSDPAQQKRKIFTNKCERAGCRQREMMKLTCERCSRNFCIKHRHP Database link: Q8WV99 Run BLAST with Run BLAST with;Species Reactivity:Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Zebrafish;Isotype:IgG;Application:WB;Storage Buffer:Immunogen affinity purified;Storage Procedures:Constituents: 98% PBS, 2% Sucrose;
Synthetic peptide within Human ZFAND2B aa 80-129 (N terminal). The exact sequence is proprietary. (NP_620157.1) Sequence: IDRDCRSDPAQQKRKIFTNKCERAGCRQREMMKLTCERCSRNFCIKHRHP Database link: Q8WV99 Run BLAST with Run BLAST with
Species Reactivity:
Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Zebrafish