Rabbit Anti-ZDHHC11B Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-49542P

• Product Name:
• Rabbit Anti-ZDHHC11B Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human ZDHHC11B aa 1-50 (N terminal). The exact sequence is proprietary. Sequence: MDTRSGSQCSVTPEAIRNNEELVLPPRISRVNGWSLPLHYFRVVTWAVFV Database link: P0C7U3 Run BLAST with Run BLAST with

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Immunogen affinity purified

• Storage Procedures:
• Constituents: 2% Sucrose, 98% PBS

• Clonality:
• Polyclonal

• Form:
• Liquid