Cat#:FPA-49535P;Product Name:Rabbit Anti-ZCCHC18 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human ZCCHC18 aa 324-373 (C terminal). The exact sequence is proprietary. Sequence: SGGSGYKNDGPGNIRRARKRKYTTRCSYCGEEGHSKETCDNESNKAQVFE Database link: P0CG32 Run BLAST with Run BLAST with;Species Reactivity:Human;Isotype:IgG;Application:WB;Storage Buffer:Immunogen affinity purified;Storage Procedures:Constituents: 2% Sucrose, 98% PBS;
Synthetic peptide within Human ZCCHC18 aa 324-373 (C terminal). The exact sequence is proprietary. Sequence: SGGSGYKNDGPGNIRRARKRKYTTRCSYCGEEGHSKETCDNESNKAQVFE Database link: P0CG32 Run BLAST with Run BLAST with