Rabbit Anti-ZC3H3 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-49531P

• Product Name:
• Rabbit Anti-ZC3H3 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human ZC3H3 aa 2-51 (N terminal). The exact sequence is proprietary. Sequence: EPGGEPTGAKESSTLMESLAGRLDPAGSCSRSLASRAVQRSLAIIRQARQ Database link: Q8IXZ2-2 Run BLAST with Run BLAST with

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Immunogen affinity purified

• Storage Procedures:
• Constituents: 98% PBS, 2% Sucrose

• Clonality:
• Polyclonal

• Form:
• Liquid