Rabbit Anti-ZBBX Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-49509P

• Product Name:
• Rabbit Anti-ZBBX Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human ZBBX aa 84-133 (N terminal). The exact sequence is proprietary. Sequence: QNKGNVVKFSAGKVKLKLLKEQIQEPVKPTVNYKMANSSECEKPKINGKV Database link: A8MT70 Run BLAST with Run BLAST with

• Species Reactivity:
• Human Predicted to work with: Rabbit, Horse, Pig

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Immunogen affinity purified

• Storage Procedures:
• Constituents: 2% Sucrose, 98% PBS

• Clonality:
• Polyclonal

• Form:
• Liquid