Rabbit Anti-Z DNA binding protein Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-44987P

• Product Name:
• Rabbit Anti-Z DNA binding protein Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to Human Z DNA binding protein aa 144-193 (internal sequence). Sequence: LYRMKSRHLLDMDEQSKAWTIYRPEDSGRRAKSASIIYQHNPINMIC

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• ELISA, WB

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS.

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid