Rabbit Anti-YIF1A Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-44947P

• Product Name:
• Rabbit Anti-YIF1A Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• antigen sequence corresponding to aa 240-269 ( ALMYFIVRSLRTAALGPDSMGGPVPRQRLQ ) of Human YIF1A.

• Species Reactivity:
• Mouse, Rat, Human

• Isotype:
• IgG

• Application:
• IHC-P, WB, ICC/IF

• Storage Buffer:
• pH: 7.20 Preservative: 0.02% Sodium azide Constituents: 59% PBS, 40% Glycerol

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid