Rabbit Anti-XKR8 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-49474P

• Product Name:
• Rabbit Anti-XKR8 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human XKR8 aa 346-395 (C terminal). The exact sequence is proprietary. Genbank: NP_060523 Sequence: CWKPDPDQVDGARSLLSPEGYQLPQNRRMTHLAQKFFPKAKDEAASPVKG Database link: Q9H6D3 Run BLAST with Run BLAST with

• Species Reactivity:
• Human Predicted to work with: Rabbit

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Immunogen affinity purified

• Storage Procedures:
• Constituents: 98% PBS, 2% Sucrose

• Clonality:
• Polyclonal

• Form:
• Liquid