Rabbit Anti-wdyhv1 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-49431P

• Product Name:
• Rabbit Anti-wdyhv1 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fragment corresponding to Human wdyhv1 aa 70-137. Sequence: RPGDGPVIWDYHVVLLHVSSGGQNFIYDLDTVLPFPCLFDTYVEDAFKSD DDIHPQFRRKFRVIRADS Database link: Q96HA8 Run BLAST with Run BLAST with

• Species Reactivity:
• Human Predicted to work with: Cow

• Isotype:
• IgG

• Application:
• ICC/IF

• Storage Buffer:
• Immunogen affinity purified

• Storage Procedures:
• pH: 7.20 Preservative: 0.02% Sodium azide Constituents: 40% Glycerol, PBS

• Clonality:
• Polyclonal

• Form:
• Liquid