Rabbit Anti-WDR45L Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-49406P

• Product Name:
• Rabbit Anti-WDR45L Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within N terminal aa 65 - 114 ( YLALVGGGKKPKYPPNKVMIWDDLKKKTVIEIEFSTEVKAVKLRRDRIVV ) of Rat WDR45L (NP_001034676). Run BLAST with Run BLAST with

• Species Reactivity:
• Rat Predicted to work with: Mouse, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Human, Zebrafish

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Immunogen affinity purified

• Storage Procedures:
• Constituents: 97% PBS, 2% Sucrose

• Clonality:
• Polyclonal

• Form:
• Liquid