Rabbit Anti-WDR21A Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-49393P

• Product Name:
• Rabbit Anti-WDR21A Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human WDR21A aa 441-490 (C terminal). The exact sequence is proprietary. Sequence: WSLHDARLLRTIPSPYPASKADIPSVAFSSRLGGSRGAPGLLMAVGQDLY Database link: Q8WV16 Run BLAST with Run BLAST with

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Immunogen affinity purified

• Storage Procedures:
• Constituents: 98% PBS, 2% Sucrose

• Clonality:
• Polyclonal

• Form:
• Liquid