Cat#:FPA-44465P;Product Name:Rabbit Anti-VTA1 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Recombinant fragment corresponding to Human VTA1 aa 158-227. Sequence: NGETPQAGPVGIEEDNDIEENEDAGAASLPTQPTQPSSSSTYDPSNMPSG NYTGIQIPPGAHAPANTPAE ;Species Reactivity:Human Predicted to work with: Cow, Orangutan;Isotype:IgG;Application:ICC/IF, WB;Storage Buffer:pH: 7.2 Preservative: 0.02% Sodium azide Constituents: 59% PBS, 40% Glycerol;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;