Cat#:FPA-44400P;Product Name:Rabbit Anti-VPS37A Polyclonal Antibody;Host Species:Rabbit ;Immunogen:A synthetic peptide corresponding to a region within the N terminal aa 1-50 (SWLFPLTKSASSSAAGSPGGLTSLQQQKQRLIESLRNSHSSIAEIQKDV E) of Human VPS37A (NP_689628).;Species Reactivity:Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish;Isotype:IgG;Application:WB;Storage Buffer:Preservative: None Constituents: 2% Sucrose, PBS;Storage Procedures:Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.;
A synthetic peptide corresponding to a region within the N terminal aa 1-50 (SWLFPLTKSASSSAAGSPGGLTSLQQQKQRLIESLRNSHSSIAEIQKDV E) of Human VPS37A (NP_689628).
Species Reactivity:
Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
Isotype:
IgG
Application:
WB
Storage Buffer:
Preservative: None Constituents: 2% Sucrose, PBS
Storage Procedures:
Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.