Rabbit Anti-Vitamin D Receptor Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-44316P

• Product Name:
• Rabbit Anti-Vitamin D Receptor Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human Vitamin D Receptor aa 90-120 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary. Sequence: MKEFILTDEEVQRKREMILKRKEEEALKDSL

• Species Reactivity:
• Rat Predicted to work with: Mouse, Human

• Isotype:
• IgG

• Application:
• IHC-P

• Storage Buffer:
• Preservative: 0.09% Sodium azide Constituents: 50% Glycerol, 1% BSA

• Clonality:
• Polyclonal

• Form:
• Liquid