Rabbit Anti-VEGFC Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-44193P

• Product Name:
• Rabbit Anti-VEGFC Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fragment corresponding to Rat VEGFC aa 101-221. Produced from sera of rabbits pre-immunized with highly pure recombinant rat VEGF-C (Asp101-Ile221) derived from insect cells. Sequence: DTVKLAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGAATNTFFKP PCVSVYR

• Species Reactivity:
• Mouse, Rat, Sheep, Human

• Isotype:
• IgG

• Application:
• IHC-FoFr, WB, ELISA, IHC-P

• Storage Buffer:
• pH: 7.40 Constituent: PBS

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid