• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-VEGFC Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-44193P
  • Product Name:
  • Rabbit Anti-VEGFC Polyclonal Antibody
  • Host Species:
  • Rabbit
  • Immunogen:
  • Recombinant fragment corresponding to Rat VEGFC aa 101-221. Produced from sera of rabbits pre-immunized with highly pure recombinant rat VEGF-C (Asp101-Ile221) derived from insect cells. Sequence: DTVKLAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGAATNTFFKP PCVSVYR
  • Species Reactivity:
  • Mouse, Rat, Sheep, Human
  • Isotype:
  • IgG
  • Application:
  • IHC-FoFr, WB, ELISA, IHC-P
  • Storage Buffer:
  • pH: 7.40 Constituent: PBS
  • Storage Procedures:
  • Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Goat Anti-VEGFB Polyclonal Antibody-FPA-44192P
  • Online Inquiry

    refresh