Rabbit Anti-VEGFB Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-49252P

• Product Name:
• Rabbit Anti-VEGFB Polyclonal Antibody

• Formulation:
• There are 2 isoforms produced by alternative splicing.

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human VEGFB aa 80-130 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary. Sequence: GCCPDDGLECVPTGQHQVRMQILMIRYPSSQLGEMSLEEHSQCECRPKKK D Database link: P49765 Run BLAST with Run BLAST with

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat

• Isotype:
• IgG

• Application:
• IHC-P

• Storage Buffer:
• Protein A purified

• Storage Procedures:
• Preservative: 0.09% Sodium azide Constituents: 1% BSA, 50% Glycerol

• Clonality:
• Polyclonal