Cat#:FPA-44093P;Product Name:Rabbit Anti-VASP Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human VASP aa 330-380 (C terminal). The exact sequence is proprietary. Sequence: ETQPCTPSSSDYSDLQRVKQELLEEVKKELQKVKEEIIEAFVQELRKRGS P ;Species Reactivity:Mouse, Human Predicted to work with: Rabbit, Horse, Cat, Dog, Chimpanzee, Cynomolgus monkey, Rhesus monkey, Common marmoset, Orangutan, African bush elephant, Bat;Isotype:IgG;Application:WB, IP;Storage Buffer:Preservative: 0.09% Sodium azide Constituent: 99% Tris citrate/phosphate pH 7-8;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Synthetic peptide within Human VASP aa 330-380 (C terminal). The exact sequence is proprietary. Sequence: ETQPCTPSSSDYSDLQRVKQELLEEVKKELQKVKEEIIEAFVQELRKRGS P
Species Reactivity:
Mouse, Human Predicted to work with: Rabbit, Horse, Cat, Dog, Chimpanzee, Cynomolgus monkey, Rhesus monkey, Common marmoset, Orangutan, African bush elephant, Bat
Isotype:
IgG
Application:
WB, IP
Storage Buffer:
Preservative: 0.09% Sodium azide Constituent: 99% Tris citrate/phosphate pH 7-8
Storage Procedures:
Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.
USA: 1-862-686-3631
Fax: 1-323-978-5598
Email: