Rabbit Anti-VAMP8 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-49235P

• Product Name:
• Rabbit Anti-VAMP8 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Rat VAMP8 aa 40-89 (internal sequence). The exact sequence is proprietary. (NP_114015). Sequence: LDHLRNKTEDLEATSEHFKTTSQKVARKFWWKNVKMIVIICVIVLIILIL Database link: Q9WUF4 Run BLAST with Run BLAST with

• Species Reactivity:
• Rat Predicted to work with: Mouse, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Human, Zebrafish

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Immunogen affinity purified

• Storage Procedures:
• Constituents: 98% PBS, 2% Sucrose

• Clonality:
• Polyclonal

• Form:
• Liquid