Rabbit Anti-UTP11L Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-49211P

• Product Name:
• Rabbit Anti-UTP11L Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human UTP11L aa 9-58 (N terminal). The exact sequence is proprietary. (NP_057121). Sequence: AKSRQREHRERSQPGFRKHLGLLEKKKDYKLRADDYRKKQEYLKALRKKA Database link: Q9Y3A2 Run BLAST with Run BLAST with

• Species Reactivity:
• Human Predicted to work with: Rat, Horse, Guinea pig, Cow, Cat, Dog, Saccharomyces cerevisiae

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Immunogen affinity purified

• Storage Procedures:
• Constituents: 2% Sucrose, 98% PBS

• Clonality:
• Polyclonal

• Form:
• Liquid