Cat#:FPA-43954P;Product Name:Rabbit Anti-USP36 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide corresponding to aa 1070 - 1121 of Human USP36 ( WDEEFDRGKEKKIKKFKREKRRNFNAFQKLQTRRNFWSVTHPAKAASLSY RR )(NP_079366.2) ;Species Reactivity:Human Predicted to work with: Mouse, Horse, Dog, Chimpanzee, Rhesus monkey, Gorilla, Orangutan, Bat;Isotype:IgG;Application:IHC-P;Storage Buffer:Preservative: 0.09% Sodium Azide Constituents: 0.1% BSA, Tris buffered saline;Storage Procedures:Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.;