Cat#:FPA-43809P;Product Name:Rabbit Anti-UQCRH Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Fusion protein corresponding to Human UQCRH aa 1-91. Full length fusion protein: The identity of the protein fusion partner is GST Sequence: MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERL ELCDERVSSRSHTEEDCTEELFDFLHARDHCVAHKLFNNLK ;Species Reactivity:Mouse Predicted to work with: Human;Isotype:IgG;Application:WB;Storage Buffer:pH: 7.4 Preservative: 0.05% Sodium azide Constituents: 59% PBS, 40% Glycerol;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Fusion protein corresponding to Human UQCRH aa 1-91. Full length fusion protein: The identity of the protein fusion partner is GST Sequence: MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERL ELCDERVSSRSHTEEDCTEELFDFLHARDHCVAHKLFNNLK