Rabbit Anti-UQCRH Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-43809P

• Product Name:
• Rabbit Anti-UQCRH Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Fusion protein corresponding to Human UQCRH aa 1-91. Full length fusion protein: The identity of the protein fusion partner is GST Sequence: MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERL ELCDERVSSRSHTEEDCTEELFDFLHARDHCVAHKLFNNLK

• Species Reactivity:
• Mouse Predicted to work with: Human

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• pH: 7.4 Preservative: 0.05% Sodium azide Constituents: 59% PBS, 40% Glycerol

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid