Rabbit Anti-UPK3BL Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-49171P

• Product Name:
• Rabbit Anti-UPK3BL Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human UPK3BL aa 146-195. The exact sequence is proprietary. NP_001107875. Sequence: PTKIGCNHPLPGPGPYRVKFLVMNDEGPVAETKWSSDTRLQQAQALRAVP Database link: B0FP48 Run BLAST with Run BLAST with

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Immunogen affinity purified

• Storage Procedures:
• Constituents: 98% PBS, 2% Sucrose

• Clonality:
• Polyclonal

• Form:
• Liquid