Rabbit Anti-UBL3 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-49113P

• Product Name:
• Rabbit Anti-UBL3 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within C terminal aa 66-115 (FLHGNVTLGALKLPFGKTTVMHLVARETLPEPNSQGQRNREKTGESNCC V) of Rat UBL3 (NP_001015030). Run BLAST with Run BLAST with

• Species Reactivity:
• Rat Predicted to work with: Mouse, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Immunogen affinity purified

• Storage Procedures:
• Constituents: 97% PBS, 2% Sucrose

• Clonality:
• Polyclonal

• Form:
• Liquid