Rabbit Anti-Ube4a Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-43583P

• Product Name:
• Rabbit Anti-Ube4a Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human Ube4a aa 1016-1066 (C terminal). The exact sequence is proprietary. NP_001191006.1. Sequence: RSTIARHLLSDQTDPFNRSPLTMDQIRPNTELKEKIQRWLAERKQQKEQL E

• Species Reactivity:
• Human Predicted to work with: Rat, Guinea pig, Dog, Chimpanzee, Rhesus monkey, Gorilla, Chinese hamster, Orangutan, Xenopus tropicalis

• Isotype:
• IgG

• Application:
• IP, WB

• Storage Buffer:
• Preservative: 0.09% Sodium azide Constituent: 99% Tris citrate/phosphate pH 7 to 8

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid