Rabbit Anti-UBE2Z Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-49106P

• Product Name:
• Rabbit Anti-UBE2Z Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Rat UBE2Z aa 208-257 (C terminal). The exact sequence is proprietary. NP_001032732 Sequence: ISSVLISIQSLMTENPYHNEPGFEQERHPGDSKNYNECIRHETIRVAVCD Database link: Q3B7D1 Run BLAST with Run BLAST with

• Species Reactivity:
• Rat Predicted to work with: Mouse, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Human, Zebrafish

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Immunogen affinity purified

• Storage Procedures:
• Constituents: 2% Sucrose, 98% PBS

• Clonality:
• Polyclonal

• Form:
• Liquid