• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-Uba6 Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-43489P
  • Product Name:
  • Rabbit Anti-Uba6 Polyclonal Antibody
  • Host Species:
  • Rabbit
  • Immunogen:
  • Synthetic peptide within Human Uba6 aa 200-250. The exact sequence is proprietary. NP_060697.4 Sequence: GDEFEVLDTTGEEPKEIFISNITQANPGIVTCLENHPHKLETGQFLTFRE I
  • Species Reactivity:
  • Mouse, Human Predicted to work with: Chicken, Cow, Pig, Chimpanzee, Gorilla, Orangutan, Zebra finch
  • Isotype:
  • IgG
  • Application:
  • WB
  • Storage Procedures:
  • Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Rabbit Anti-Uba6 Polyclonal Antibody-FPA-43488P
  • Online Inquiry

    refresh