Rabbit Anti-Uba6 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-43489P

• Product Name:
• Rabbit Anti-Uba6 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human Uba6 aa 200-250. The exact sequence is proprietary. NP_060697.4 Sequence: GDEFEVLDTTGEEPKEIFISNITQANPGIVTCLENHPHKLETGQFLTFRE I

• Species Reactivity:
• Mouse, Human Predicted to work with: Chicken, Cow, Pig, Chimpanzee, Gorilla, Orangutan, Zebra finch

• Isotype:
• IgG

• Application:
• WB

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid