Rabbit Anti-UBA5 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-43482P

• Product Name:
• Rabbit Anti-UBA5 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human UBA5 aa 325-375. The exact sequence is proprietary. (NP_079094.1) Sequence: QEVIQEEEEIIHEDNEWGIELVSEVSEEELKNFSGPVPDLPEGITV AYTIP

• Species Reactivity:
• Human Predicted to work with: Cow, Chimpanzee, Gorilla

• Isotype:
• IgG

• Application:
• WB, IP

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid