Cat#:FPA-43403P;Product Name:Rabbit Anti-TXNL2 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human TXNL2 aa 81-110 (N terminal) conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary. NP_006532.2. Sequence: EISSVPTFLFFKNSQKIDRLDGAHAPELTK ;Species Reactivity:Mouse, Human;Isotype:IgG;Application:Flow Cyt, IHC-P, WB;Storage Buffer:Preservative: 0.09% Sodium azide Constituent: 99% PBS;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Synthetic peptide within Human TXNL2 aa 81-110 (N terminal) conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary. NP_006532.2. Sequence: EISSVPTFLFFKNSQKIDRLDGAHAPELTK