Cat#:FPA-43335P;Product Name:Rabbit Anti-TULP2 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide corresponding to a region within N terminal aa 2 - 51 ( SQDNDTLMRDILGHELAAMRLQKLEQQRRLFEKKQRQKRQELLMVQANPD ) of Human TULP2 (NP_003314) ;Species Reactivity:Human Predicted to work with: Mouse, Rat, Horse, Cow, Cat;Isotype:IgG;Application:IHC-P, WB;Storage Buffer:Preservative: None Constituents: 2% Sucrose, PBS;Storage Procedures:Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.;
Synthetic peptide corresponding to a region within N terminal aa 2 - 51 ( SQDNDTLMRDILGHELAAMRLQKLEQQRRLFEKKQRQKRQELLMVQANPD ) of Human TULP2 (NP_003314)
Species Reactivity:
Human Predicted to work with: Mouse, Rat, Horse, Cow, Cat
Isotype:
IgG
Application:
IHC-P, WB
Storage Buffer:
Preservative: None Constituents: 2% Sucrose, PBS
Storage Procedures:
Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.