Rabbit Anti-Tuftelin 1 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-49068P

• Product Name:
• Rabbit Anti-Tuftelin 1 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Mouse Tuftelin 1 aa 201-250 (internal sequence). The exact sequence is proprietary. NP_035786 Sequence: LSRYQREAEQSNVALQREEDRVEQKAAEIEELQRRLLGMEAEHQALLVKV Database link: O08970 Run BLAST with Run BLAST with

• Species Reactivity:
• Mouse Predicted to work with: Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Human, Pig

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Immunogen affinity purified

• Storage Procedures:
• Constituents: 98% PBS, 2% Sucrose

• Clonality:
• Polyclonal

• Form:
• Liquid