Rabbit Anti-TUBA6 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-43294P

• Product Name:
• Rabbit Anti-TUBA6 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human TUBA6 aa 26-60 (N terminal) conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary. Sequence: LEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK

• Species Reactivity:
• Mouse, Human Predicted to work with: Rat, Chicken, Hamster, Cow, Pig, Xenopus laevis, Drosophila melanogaster, Monkey

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Preservative: 0.09% Sodium azide Constituent: 99% PBS

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid