Cat#:FPA-43283P;Product Name:Rabbit Anti-TUBA1A (acetyl K40) Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human TUBA1A aa 1-50 (N terminal) (acetyl K40). The exact sequence is proprietary. synthesized Acetyl-peptide derived from human TUBA1A around the Acetylation site of Lys40. Sequence: MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGD;Species Reactivity:Human Predicted to work with: Mouse, Rat;Isotype:IgG;Application:WB;Storage Buffer:pH: 7.4 Preservative: 0.02% Sodium azide Constituents: 49% PBS, 50% Glycerol, 0.87% Sodium chloride PBS is without Mg2+ and Ca2+;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Synthetic peptide within Human TUBA1A aa 1-50 (N terminal) (acetyl K40). The exact sequence is proprietary. synthesized Acetyl-peptide derived from human TUBA1A around the Acetylation site of Lys40. Sequence: MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGD
Species Reactivity:
Human Predicted to work with: Mouse, Rat
Isotype:
IgG
Application:
WB
Storage Buffer:
pH: 7.4 Preservative: 0.02% Sodium azide Constituents: 49% PBS, 50% Glycerol, 0.87% Sodium chloride PBS is without Mg2+ and Ca2+
Storage Procedures:
Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.
USA: 1-862-686-3631
Fax: 1-323-978-5598
Email: