• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-TTLL7 Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-49058P
  • Product Name:
  • Rabbit Anti-TTLL7 Polyclonal Antibody
  • Host Species:
  • Rabbit
  • Immunogen:
  • Recombinant fragment corresponding to Human TTLL7 aa 568-638. Sequence: EEYQNKKREKQVTYNLKPSNHYKLIQQPSSIRRSVSCPRSISAQSPSSGD TRPFSAQQMISVSRPTSASRS Database link: Q6ZT98 Run BLAST with Run BLAST with
  • Species Reactivity:
  • Human
  • Isotype:
  • IgG
  • Application:
  • IHC-P
  • Storage Buffer:
  • Immunogen affinity purified
  • Storage Procedures:
  • pH: 7.2 Preservative: 0.02% Sodium azide Constituents: 59% PBS, 40% Glycerol
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Rabbit Anti-TTLL12 Polyclonal Antibody-FPA-49057P
  • Online Inquiry

    refresh