• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-TTC39C Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-49050P
  • Product Name:
  • Rabbit Anti-TTC39C Polyclonal Antibody
  • Host Species:
  • Rabbit
  • Immunogen:
  • Synthetic peptide within Human TTC39C aa 175-224 (internal sequence). The exact sequence is proprietary. (NP_694943). Sequence: NLLKIINLLGFPGDRLQGLSSLMYASESKDMKAPLATLALLWYHTVVRPF Database link: Q8N584-2 Run BLAST with Run BLAST with
  • Species Reactivity:
  • Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Isotype:
  • IgG
  • Application:
  • WB
  • Storage Buffer:
  • Immunogen affinity purified
  • Storage Procedures:
  • Constituents: 2% Sucrose, 98% PBS
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Rabbit Anti-TTC35 Polyclonal Antibody-FPA-49049P
  • Online Inquiry

    refresh