Rabbit Anti-TTC39C Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-49050P

• Product Name:
• Rabbit Anti-TTC39C Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human TTC39C aa 175-224 (internal sequence). The exact sequence is proprietary. (NP_694943). Sequence: NLLKIINLLGFPGDRLQGLSSLMYASESKDMKAPLATLALLWYHTVVRPF Database link: Q8N584-2 Run BLAST with Run BLAST with

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Immunogen affinity purified

• Storage Procedures:
• Constituents: 2% Sucrose, 98% PBS

• Clonality:
• Polyclonal

• Form:
• Liquid