Rabbit Anti-TTC23 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-49041P

• Product Name:
• Rabbit Anti-TTC23 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human TTC23 aa 383-432 (C terminal). The exact sequence is proprietary. Sequence: LQIQTLLYGPQDKRTLATQQAMGMLSTAPKVASKPRQASKAKVAFCTSIP Database link: Q5W5X9 Run BLAST with Run BLAST with

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Immunogen affinity purified

• Clonality:
• Polyclonal

• Form:
• Liquid