Rabbit Anti-TTC22 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-49039P

• Product Name:
• Rabbit Anti-TTC22 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human TTC22 aa 146-195 (N terminal). The exact sequence is proprietary. Sequence: AARCLAEQGYAHGFDVGCASPEERARGLAAGIALYDKALGYGQQIPMEEK Database link: Q5TAA0 Run BLAST with Run BLAST with

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Cow, Cat, Pig

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Immunogen affinity purified

• Storage Procedures:
• Constituents: 2% Sucrose, 98% PBS

• Clonality:
• Polyclonal

• Form:
• Liquid