Cat#:FPA-43182P;Product Name:Rabbit Anti-TSTA3 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide corresponding to Human TSTA3 aa 221-270. Sequence: LDLAQLFIWVLREYNEVEPIILSVGEEDEVSIKEAAEAVVEAMDFHGEVT ;Species Reactivity:Rat, Human Predicted to work with: Mouse, Chinese hamster, Orangutan;Isotype:IgG;Application:WB, IHC-P;Storage Buffer:pH: 7.40 Preservative: 0.02% Sodium azide Constituents: 49% PBS, 0.87% Sodium chloride PBS is without Mg2+ and Ca2+;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;